<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SJ_Pat25 SJKLM007 Rwanda 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, L19I, M36I, R41K, L63P  
>SJKLM007| codons 4-99
TLWQRPLVTIRIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I37X, I47L, S48T, K49R, V60I, K122E, I135T, T139V, D177E, I178M, T200I, Q207E, R211K, I244V, V245N  
>SJKLM007| codons 37-247
XCTEMEKEGKLTRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNEVPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPVNLP

References
Author Title Citation
Servais, J HIV type 1 pol gene diversity and archived nevirapine resistance mutation in pregnant women in Rwanda. ARHR, 2004