<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat42 BR02SP154 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 21
2 RTV+ 3TC+ AZT 13
3 3TC+ AZT+ EFV 21
4 Unknown NA
5 NFV+ 3TC+ AZT+ EFV 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12R, I15V, L19S, K20T, E35D, M36I, R41K, R57K, Q61N, I62V, T74S, V77I, L89M, I93IL  
>BR02SP154| codons 1-99
PQITLWQRPLVRIKVGGQSTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NVLIEICGHKAIGSVLIGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V T215D L100I, K103N   V35T, E169D, K173T, Q174K, T200A, Q207D, R211K, V245Q, E248D, T286A, E291D, V292I, I293V, E297A  
>BR02SP154| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005