<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat41 BR02SP138 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 8
2 DDI 30
3 3TC+ AZT 186
4 Unknown NA
5 NFV+ D4T+ 3TC 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46ML N88D L10V, I13V, I15V, K20R, E35D, M36I, N37NI, R41K, K45KR, R57K, Q61D, A71T, I72T  
>BR02SP138| codons 1-99
PQITLWQRPVVTVKVGGQLREALLDTGADNTVLEDIILPGKWKPRLIGGIGGFIKVKQYD
DILIEICGHKTTGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, T215Y       E6D, K20R, V35T, T39A, K43Q, E44D, K49R, V118I, K122E, I135V, S162C, E169D, K173A, Q174K, I178L, E203A, Q207E, H208Y, R211K, K223Q, L228Q, V245Q, E248DN, D250DE, A272P, T286A, E291D, V292I, I293V, P294T, E297A  
>BR02SP138| codons 1-335
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEQDGKISRIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVI
YQYVDDLYVGSDLEIGQHRTKIAELREYLLKWGFYTPDKKHQQEPPFQWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005