<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat38 BR03SP211 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT+ NVP 52
2 RTV+ IDV+ D4T+ 3TC 52
3 D4T+ 3TC+ NVP 99

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, H69Y, I72T, L89M  
>BR03SP211| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGYKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215F   L100I, K103N   K20R, V35T, T39S, K122E, E169D, K173A, Q174K, D177DG, T200A, E203K, Q207E, H208Y, R211K, K223E, L228R, V245Q, E248D, A272P, E291D, V292I, I293V, E297A, I326V, I329V  
>BR03SP211| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICSELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPGIVI
YQYVDDLYVGSDLEIGQHRAKIKELREYLLKWGFFTPDKKHQEEPPFRWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005