<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat37 BR03SP90 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDI 43
2 IDV+ D4T+ 3TC 39
3 RTV+ D4T+ 3TC 30
4 SQV+ 3TC+ AZT 39
5 Unknown NA
6 D4T+ DDI+ LPV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, K45R, R57K, D60E, Q61N, E65D, I72T, L89M  
>BR03SP90| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYE
NILIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V   K103N   E6EK, V35T, K49R, I50V, K122E, D123E, I135V, S162C, E169D, K173A, Q174K, T200A, Q207E, R211K, V245Q, E248D, A272P, T286A, E291D, I293V, E297A, G333E  
>BR03SP90| codons 1-335
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRVGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005