<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat33 BR03SP36 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ 3TC+ AZT 13
2 3TC+ AZT 43
3 DDI+ AZT+ NVP 35
4 NFV+ D4T+ DDI 73
5 IDV+ 3TC+ AZT 43
6 3TC+ AZT+ EFV 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E K101E, Y181C, G190A V108I E6D, K20R, V35T, T39L, V60I, V90I, I135R, S162H, E169D, K173A, Q174K, V179I, T200R, Q207E, R211K, L228H, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294S, E297A  
>BR03SP36| codons 1-335
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLEKKKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILDPFRAKNPDIII
CQYVDDLYVASDLEIGQHRRKIEELREHLLKWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVSLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L L10F, N88T K14R, I15V, K20T, E35N, M36I, R41K, R57K, Q61N, I72V, L89M  
>BR03SP36| codons 1-99
PQITLWQRPFVTIRVGGQLTEALLDTGADDTVLENINLPGKWKPKLIGGIGGFIKVKQYD
NILIEICGHKAVGTVLVGPTPVNIIGRTMLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005