<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat32 BR02SP56 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ AZT 208
2 IDV+ D4T+ 3TC 82
3 Unknown NA
4 NFV+ D4T+ DDI+ NVP 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82L, L90M K43T L10V, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, L89M, I93L  
>BR02SP56| codons 9-99
PVVTIKVGGQLREALLDTGADDTVLEDINLPGKWTPKMIGGIGGFIKVKQYDNIPIEICG
HKAIGTVLVGPTPLNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, L210W, T215Y   K103KN, Y181C   K32I, V35T, T39S, K49R, V118I, K122E, D123E, I135V, K173T, Q174K, I178M, T200TA, Q207E, R211K, V245Q, E248D, A272P, Q278H, T286P, E291D, V292I, I293V, P294T, E297A, S322T, Q334N  
>BR02SP56| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICSELEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDMVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGPKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGNG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005