<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat31 BR03SP35 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC 113
2 NFV+ D4T+ 3TC 12
3 RTV+ D4T+ 3TC 21
4 D4T+ 3TC+ EFV 119

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, I15V, E35D, M36I, R41K, R57K, Q61N, L63V, V82I, L89M  
>BR03SP35| codons 1-99
PQITLWQRPLVNIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NIVIEICGHKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K101P, K103N   K20R, E28K, V35T, D123E, E169D, K173A, Q174K, T200A, Q207E, R211K, V245Q, E248N, D250E, A272P, T286V, E291D, V292I, I293V, E297T, V317A  
>BR03SP35| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGVKALTDIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005