<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat30 BR03SP179 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ DDI+ AZT 95
2 RTV+ IDV+ D4T+ 3TC 4
3 Unknown NA
4 D4T+ 3TC+ NVP 34
5 RTV+ 3TC+ AZT+ APV 4
6 APV+ RTV+ 3TC+ AZT+ LPV 8
7 Unknown NA
8 NFV+ 3TC+ AZT 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13IV, E35D, M36I, R41K, R57K, D60E, Q61N, I72IT, V77I, L89M  
>BR03SP179| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
NILIEICGHKATGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39X, K122KE, D123E, I135V, S162C, E169ED, K173A, Q174K, D177E, I178L, T200A, Q207D, R211K, T215X, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294PT, E297V  
>BR03SP179| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICXEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTVEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005