<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat29 BR03SP247 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 82
2 Unknown NA
3 NFV+ D4T+ 3TC 60
4 D4T+ 3TC+ NVP 52
5 RTV+ SQV+ DDI+ AZT 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A N83D L10I, I15V, G16E, K20R, E35D, M36I, R41K, K45R, R57K, Q61N, L63T, I72T, L89M, I93L  
>BR03SP247| codons 1-99
PQITLWQRPIVTIKVEGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFVKVKQYD
NITIEICGHKATGTVLVGPTPADIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y   K101E, Y181I   E6K, V35MR, T39A, K122E, S162D, F171Y, K173T, Q174K, E203K, Q207E, R211K, K223Q, A272P, K277R, L283I, T286A, E291D, V292I, I293V, E297A, V317A, G333E, Q334Y  
>BR03SP247| codons 1-335
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPYRTKNPDIVI
IQYMDDLYVGSDLEIGQHRTKIKELREHLLKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGAKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQEYG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005