<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat28 BR02SP258 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ D4T+ 3TC 71

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, N88NS, L90LM   G17E, K20R, E35D, M36I, R41K, R57K, Q61N, L63C, E65D, L89M  
>BR02SP258| codons 1-99
PQITLWQRPLVTIKIGEQLREALLDTGADDTVLEDINLPGKWKPKLIGGIGGFIKVKQYD
NICIDICGHKAIGTVLVGPTPVNIIGRSMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V     V35T, D123DE, I135V, S162C, E169D, K173A, Q174K, I178L, V179VI, Q207D, L210M, R211K, V245Q, E248D, S251SI, A272P, K275Q, T286A, E291D, V292I, I293V, E297A, S322A, D324E, Q334H  
>BR02SP258| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLII
YQYVDDLYVGSDLEIGQHRTKIEELRDHLMKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDIWTVNDIQKLVGKLNWASQIYPGIQVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPAKELIAEIQKQGHG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005