<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat25 BR02SP184 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ D4T+ 3TC 113
2 DDI+ AZT 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I15V, K20R, E35D, M36I, P39Q, R41K, R57K, Q61N, I62V, L63A, T74S, L89M  
>BR02SP184| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLQGKWKPKMIGGIGGFIKVKQYD
NVAIEICGHKAIGSVLVGPTPVNIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       S3R, E6D, E28K, K32E, V35T, T39M, K49R, I135V, S162C, E169D, K173A, Q174K, I178L, T200K, E203D, Q207A, R211Q, V245Q, E248D, A272P, K277R, T286A, V292I, I293V, E297T, I329L  
>BR02SP184| codons 1-335
PIRPIDTVPVKLKPGMDGPKVKQWPLTKEKIEALTEICMEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVI
YQYVDDLYVGSDLEIGQHRKKIDELRAHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005