<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat24 BR02SP255 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 DDI+ AZT 65
3 IDV+ 3TC+ AZT 95
4 RTV+ SQV+ D4T+ 3TC 82
5 NFV+ D4T+ 3TC+ NVP 71

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48V, I54T, V82A   L10I, I15V, L19LI, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, C67D, A71V, I72T, I93L  
>BR02SP255| codons 1-99
PQITLWQRPIVTIKVGGQIREALLDTGADDTVLEDINLPGKWKPKIIVGIGGFTKVKQYD
NIPIEIDGHKVTGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K101E, Y181C, G190A   V35T, T39PS, K43N, E44D, V118I, K122E, I135V, S162Y, K173T, Q174K, N175Y, T200A, E203K, Q207D, R211K, K223Q, V245Q, E248D, T286A, A288T, V292I, I293V, E297A, Q334E  
>BR02SP255| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICPELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKYPDIVI
CQYVDDLYVASDLEIGQHRAKIKELRDHLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKTLTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005