<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat23 BR03SP224 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NVP 52
2 Unknown NA
3 RTV+ D4T+ 3TC+ APV 4
4 Unknown 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I50V, I54V, V82A, L90M L23I, F53L, L76M L10I, I15V, K20R, E35D, M36I, R41K, K45R, R57K, Q61N, L63A, I64M, L89M, I93L  
>BR03SP224| codons 1-99
PQITLWQRPIVTIKVGGQLREAILDTGADDTVLEDINLPGKWKPRIIGGVGGLVKVKQYD
NIAMEICGHKAIGTVMVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215SY K219EQ     V35T, T39M, I135V, S162C, K166R, E169D, K173T, Q174K, Q207E, K223KE, L228LH, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297V, V317A, I329L  
>BR03SP224| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILDPFRTKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFSTPDEKHQEEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTVEAE
LELAENREILKEPVHGAYYDPSKDLIAELQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005