<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat22 BR03SP87 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 95
2 RTV+ D4T+ 3TC 91
3 NFV+ 3TC+ AZT+ NVP 43
4 APV+ D4T+ DDI 47
5 APV+ RTV+ 3TC+ AZT 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, Q58E L10I, I15V, K20R, E35D, M36I, R41K, K55R, R57K, D60E, Q61N, L63P, T74A, L89M  
>BR03SP87| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADDTVLEDINLPGKWKPKLIGGIGGFVRVKEYE
NIPIEICGHKAIGAVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K101E, Y181CG, G190GA   E6N, K20R, V35T, T39K, K43E, E44D, V118I, K122E, I135V, S162Y, K173A, Q174K, V179VI, Q207E, R211K, L228H, Q242X, V245Q, A272P, K275Q, V276T, T286A, A288T, E291D, V292I, I293V, P294S, E297T  
>BR03SP87| codons 1-335
PISPINTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKELEEDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAKNPDIII
CQYVDDLYVASDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VXPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIQTKQLCKLLRGAKTLTDIVSLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005