<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat21 BR02SP235 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 DDI+ AZT 134
3 IDV+ 3TC+ AZT 165
4 D4T+ 3TC+ EFV 113
5 Unknown 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10V, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63V, A71V, I72T, L89I, Q92K, I93L  
>BR02SP235| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
NIVIEICGHKVTGTVLVGPTPANIIGRNIMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E   A98G V35T, T39A, T69N, V118I, K122E, I135T, S162A, F171Y, K173A, Q174K, Q207E, R211K, F214L, L228H, V245Q, E248D, A272P  
>BR02SP235| codons 1-275
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPYRAKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIK

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005