<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat20 BR03SP220 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 30
2 3TC+ AZT 30
3 Unknown NA
4 NFV+ D4T+ 3TC 173
5 DDI+ AZT+ EFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, L63LP, E65D, T74S, L89M  
>BR03SP220| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NVPIDICGHKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F V75M, K219Q K103N V179E, K238T V35T, T39TI, V60I, T69N, K122E, D123S, E138Q, E169D, K173A, Q174K, I178L, T200A, H208Y, R211A, D218DE, V245Q, E248D, A272P, T286A, A288T, E291D, V292I, I293V, E297A, I329L  
>BR03SP220| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIELEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDLEI
YQYMDDLYVGSDLEIGQHRAKIEELRQYLLAWGFFTPEQKHQKEPPFLWMGYELHPDTWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005