<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat18 BR03SP130 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 47
2 NVP+ 3TC+ D4T+ NFV 65
3 3TC+ D4T+ SQV+ RTV 87

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V K219KE Y181C A98G V35T, V118I, D121H, K122E, E169D, K173A, Q174K, D177E, I178L, V179VI, T200A, Q207E, R211K, F214L, L228LH, V245Q, E248D, A272P, K277R, E291D, V292I, I293V, E297A, I329L  
>BR03SP130| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPELII
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDEKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005