<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat17 BR02SP88 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 DDI+ AZT 21
3 SQV+ DDI+ AZT 17
4 IDV+ 3TC+ AZT 30
5 RTV+ SQV+ D4T+ 3TC 21
6 NFV+ DDI+ AZT+ NVP 47
7 IDV+ RTV+ D4T+ 3TC+ DLV 74
8 3TC+ AZT+ NVP+ LPV 96

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y V75S, K219E K103N A98G, V108I E6K, K20R, K32R, V35T, T39A, E44D, V118I, K122E, S162Y, E169D, K173A, Q174K, T200A, E203K, Q207E, H208Y, K223E, L228H, Q242H, V245Q, E248D, A272P, K277R, L283I, T286A, E291D, V292I, I293V, E297T, D324E, Q334E W212WL
>BR02SP88| codons 1-335
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIRALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKISDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELREYLLRLGFYTPDEKHQEEPPFHWMGYELHPDKWT
VHPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGEG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I50V, I54V, V82T, L90M K43T L10I, T12N, I15V, L19P, K20R, E21Q, E35D, M36I, N37D, K55R, R57K, Q61N, L63P, A71V, I72V, I85V, L89I, Q92K  
>BR02SP88| codons 1-99
PQITLWQRPIVNIKVGGQPRQALLDTGADDTVLEDIDLPGRWTPKLIGGVGGFVRVKQYD
NIPIEICGHKVVGTVLVGPTPTNIVGRNIMTKIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005