<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat16 BR03SP111 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 DDI+ AZT 47
3 SQV+ 3TC+ AZT 113
4 IDV+ 3TC+ AZT 34
5 NFV+ 3TC+ AZT 146

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, I13V, I15V, K20R, E35D, M36V, N37NS, R41K, R57K, Q61N, I62IV, L63LP, E65D, A71I, I72T  
>BR03SP111| codons 1-99
PQITLWQRPIVTVKVGGQLREALLDTGADNTVLEDVSLPGKWKPKMIGGIGGFIKVKQYD
NVPIDICGHKITGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219E     V35MT, K43E, E44A, T107S, L109I, D123E, S162C, K173A, Q174K, D177E, T200A, E203D, Q207D, H208Y, R211K, H221Y, L228H, V245Q, E248D, S251D, A272P, T286A, E291D, V292I, I293V, E297T, V317A, Q334C W212L
>BR03SP111| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVSVIDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIDELRDYLLKLGFYTPDEKYQKEPPFHWMGYELHPDKWT
VQPIQLPDKDDWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGCG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005