<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat13 BR03SP64 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ AZT 123

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   I15V, G16GE, L19I, K20T, E35D, M36I, N37NT, R41K, R57K, Q61D, I62IV, E65D, L89M P39HQ
>BR03SP64| codons 1-98
PQITLWQRPLVTIKVEGQITEALLDTGADDTVLEDITLHGKWKPKMIGGIGGFIKVKQYD
DVLIDICGHKAIGTVLVGPTPVNIIGRSMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39L, V60I, I135V, S162C, E169D, K173A, Q174K, T200A, R211K E28L, E29N
>BR03SP64| codons 27-220
TLNKIKALTEICLEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQD
FWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQY
NVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELR
QHLLKWGFTTPDKK

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005