<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat12 BR03SP110 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT 143
2 NFV+ D4T+ 3TC 128

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215FY       V35T, K49R, K102Q, V118VI, K122E, I135V, S162C, E169A, F171Y, K173A, Q174K, N175Y, Q207E, R211K, L228LR, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, E297T  
>BR03SP110| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILAPYRAKYPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I15L, L19I, K20I, E35D, M36I, N37S, R41K, R57K, Q61N, L63P, I64V, A71T, I72T, I93L  
>BR03SP110| codons 1-99
PQITLWQRPIVTIKLGGQIIEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVKQYD
NIPVEICGHKTTGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005