<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat11 BR03SP43 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 39
2 Unknown NA
3 3TC+ D4T+ IDV 39
4 3TC+ D4T+ SQV+ RTV 82
5 EFV+ AZT+ DDI+ NFV 30
6 EFV+ 3TC+ D4T+ IDV 26
7 NVP+ AZT+ 3TC+ IDV+ RTV 30
8 Unknown 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   T12M, I15V, L19I, K20R, E35D, M36I, N37D, R41K, R57K, Q61H, I62V, H69R, T74S, L89I, C95CF  
>BR03SP43| codons 1-99
PQITLWQRPLVMIKVGGQIREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVKQYD
HVLIEICGRKAIGSVLVGPTPANIIGRNIMTQIGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F   K101P, K103N   P4T, K20KR, E28K, K32E, V35T, K49R, V60I, I135V, S162C, E169D, K173A, Q174K, T200A, Q207E, R211K, L228H, V245Q, E248D, A272P, T286A, I293V, E297T  
>BR03SP43| codons 1-335
PISTIETVPVKLKPGMDGPRVKQWPLTKEKIEALTEICTELEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFFTPDKKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005