<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat9 BR03SP182 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 26
3 DDI+ AZT 17
4 RTV+ DDC+ D4T 8
5 RTV+ D4T+ 3TC 217
6 SQV+ NFV+ EFV+ DDI+ D4T 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DE, K70R K219Q Y181YC, G190GA K101H, K238KT P14PS, K20R, V35T, T39M, V60I, K103KR, V118VI, D123E, I135T, S162Y, K173T, Q174K, E203K, R211T, F214L, D218E, L228H, Q242X, V245Q, E248D, A272P, K275R, Q278N, T286A, A288T, E291D, V292I, I293V, E297A, V317A, S322T, D324E Q269QH
>BR03SP182| codons 1-335
PISPIETVPVKLKSGMDGPRVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKRKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPDIVI
CQYMDDLYVASDLEIGQHRTKIKELRQHLLTWGLTTPEQKHQKEPPFHWMGYELHPDTWT
VXPIQLPDKDSWTVNDIQKLVGKLNWASHIYPGIRVKNLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGAYYDPTKELIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, I13V, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, A71AT  
>BR03SP182| codons 1-99
PQITLWQRPIVTVKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
NIPIEICGHKTIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005