<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat8 BR03SP01 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 13
2 Unknown NA
3 3TC+ AZT+ NVP 43
4 Unknown NA
5 RTV+ 3TC+ AZT 17
6 Unknown NA
7 RTV+ IDV+ 3TC+ AZT 34
8 Unknown 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y   K101E, G190A A98G S3C, E6D, K20R, V35T, E44D, K49R, I135V, E138A, S162C, E169D, K173A, Q174K, I178L, T200E, E203K, Q207E, H208Y, R211K, K223E, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297T, V317A  
>BR03SP01| codons 1-335
PICPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKDGKISRIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVI
YQYVDDLYVASDLEIGQHREKIKELREYLLKWGFYTPDKKHQEEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54A, V82A L24I, K43T L10I, I15V, L19I, K20R, E35D, M36I, K55R, R57K, Q61N, L63P, A71V, I85V, L89I  
>BR03SP01| codons 1-99
PQITLWQRPIVTIKVGGQIREALIDTGADDTVLEDINLPGRWTPKLIGGIGGFARVKQYD
NIPIEICGHKVIGTVLVGPTPANIVGRNILTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005