<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat6 BR03SP164 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 Unknown NA
3 DDI+ AZT 4
4 Unknown NA
5 3TC+ AZT 52
6 SQV+ D4T+ 3TC 30
7 Unknown NA
8 NFV+ SQV+ D4T+ NVP 143
9 Unknown NA
10 SQV+ DDI+ AZT+ RTV 52
11 RTV+ DDI+ D4T+ SQV 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y181C A98G, K101HQ P4PT, V35I, K43KE, E44D, K49R, V118VI, K122E, I135T, S162C, E169D, K173A, Q174K, E203K, Q207D, R211KT, K223Q, L228R, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, E297AV, V317A, S322A  
>BR03SP164| codons 1-335
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEEDGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
CQYMDDLYVGSDLEIGQHRTKIKELRDHLWKWGFYTPDKKHQQEPPFRWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPAKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005