<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat4 BR02SP265 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI 143
2 3TC+ NVP+ D4T 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62AV, K70NS, V75I, F77L, F116Y K103N, Y181C   E6S, K20R, V21VI, V35T, T39A, K64R, S68G, K122E, S162SC, E169D, K173A, Q174K, I178L, G196E, T200A, Q207E, R211K, H221Y, V245Q, E248N, A272P, T286A, E291D, V292I, I293V, E297V, V317A  
>BR02SP265| codons 1-335
PISPISTVPVKLKPGMDGPRIKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FVIRKKDGTNWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILDPFRAKNPDLVI
CQYVDDLYVGSDLEIEQHRAKIEELREHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTVEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20R, M36I, R41K, R57K, Q61S, I72V  
>BR02SP265| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVKQYD
SILIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005