<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BLF_Pat2 BR02SP158 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT 69
2 SQV+ RTV+ AZT+ 3TC 84

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V106I, K122E, I135V, S162C, E169ED, K173A, Q174K, T200IK, Q207E, R211K, F214L, V245Q, A272P, V276I, T286A, E291D, V292I, I293V, E297A  
>BR02SP158| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, R57K, Q61N, C67Y, K70R, L89M Q18Y
>BR02SP158| codons 1-99
PQITLWQRPIVTVKIGGYLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEIYGHRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005