<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
881505 881505 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 61
2 AZT+ DDC+ IDV 13
3 AZT+ 3TC+ IDV 39
4 DDI+ D4T+ IDV 17
5 D4T+ 3TC+ RTV+ SQV 69

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V L23I, F53L L10I, I13V, I15V, L19V, K20R, M36I, I62V, L63P, I64V  
>881505| codons 1-99
PQITLWQRPIVTVKVGGQVREAILDTGADDTVLEEINLPGRWKPKIIGGIGGLIKVRQYD
QVPVEICGHKAIGTVVVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K49R, D121Y, K122E, D123E, I135T, E169K, K173E, I178M, T200A, E204D, H208Y  
>881505| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILKPFREQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEDLRQYLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWT

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005