<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
881302 881302 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 76
2 AZT+ DDC+ IDV 5
3 AZT+ DDC 48
4 D4T+ 3TC+ IDV 75

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  N88D R41K, K45R, R57K, L63P, A71T L5H
>881302| codons 1-99
PQITHWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPRMIGGIGGFIKVKQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V A62V, T215V, K219Q     I50V, F124L, I135V, T200A P119A
>881302| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKVGPENPYNTPV
FVIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVAL
DKDLRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005