<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
881220 881220 Spain 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 8
2 AZT+ DDI 60
3 D4T+ 3TC+ IDV 13
4 D4T+ 3TC+ SQV 17
5 D4T+ 3TC+ NVP 101

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L10F K14R, Q18H, N37D, R41K, L63P, A71T, I72T, Q92R, I93L  
>881220| codons 1-99
PQITLWQRPFVTIRIGGHLKEALLDTGADDTVLEEMDLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTTGTVLVGPTPVNIIGRNLLTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N   K49R, S68G, V90I, D123E, I135T, S162D, K166R, D177E, I178M, R211K  
>881220| codons 1-226
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPP

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005