<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880915 880915 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 95
2 DDI 39
3 DDC 91
4 AZT 13
5 AZT+ RTV 26
6 AZT+ 3TC+ RTV+ SQV 8
7 D4T+ 3TC+ RTV+ SQV 17
8 DDI+ D4T+ RTV+ SQV 113

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V, L90M K43T L10I, I15V, K20R, E35D, M36I, I62V, L63P, A71I  
>880915| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGRWTPKMIGGIGGFVKVRQYD
QVPIEICGHKIIGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     V35M, T69N, A98S, K122E, R199K, T200V, V245M  
>880915| codons 1-256
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHKVKIEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVND

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005