<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880911 880911 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 DDI 61
3 DDI+ RTV 21
4 DDI+ D4T+ RTV 17
5 DDI+ D4T+ RTV+ SQV 82
6 DDI+ D4T+ EFV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M   L10I, I15V, K20R, E35D, M36I, L63P, A71V  
>880911| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103N, G190A   V35T, K122E, T200A, E204D T128I
>880911| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYIAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRAKIEDLRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005