<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880908 880908 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 182
2 DDC 26
3 DDI 13
4 DDI+ RTV 17
5 D4T+ RTV 8
6 D4T+ 3TC+ RTV 26
7 D4T+ 3TC+ RTV+ SQV 21
8 D4T+ 3TC+ NFV 90

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, L33F, G73S L10I, N37D, I62V, L63P, A71T, I72T, V77I, Q92K  
>880908| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVFEEMDLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKTTSTVLIGPTPANIIGRNLLTKIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005