Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| 880908 | 880908 | Spain | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 182 |
| 2 | DDC | 26 |
| 3 | DDI | 13 |
| 4 | DDI+ RTV | 17 |
| 5 | D4T+ RTV | 8 |
| 6 | D4T+ 3TC+ RTV | 26 |
| 7 | D4T+ 3TC+ RTV+ SQV | 21 |
| 8 | D4T+ 3TC+ NFV | 90 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, V82A | L24I, L33F, G73S | L10I, N37D, I62V, L63P, A71T, I72T, V77I, Q92K |
| >880908| codons 1-99 PQITLWQRPIVTIKIGGQLKEALIDTGADDTVFEEMDLPGRWKPKIIGGIGGFVKVRQYD QVPIEICGHKTTSTVLIGPTPANIIGRNLLTKIGCTLNF |
References
| Author | Title | Citation |
| Tural, C | Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. | AIDS, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |