<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880904 880904 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 70
2 D4T 127
3 DDI+ D4T 8
4 DDI 14
5 AZT+ 3TC+ RTV 9
6 AZT+ 3TC+ IDV 40
7 AZT+ 3TC+ SQV 10
8 D4T+ NVP+ NFV 49
9 DDI+ D4T+ NVP+ NFV 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q K103N, Y181C, G190A   K20R, V35R, T39A, K49Q, V60I, T69N, D123E, I135T, S162D, I202V, H221Y, L228H  
>880904| codons 1-250
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALREICAELEKEGKISQIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKVEELRQHLLRWGFFTPDQKYQKEPPFHWMGYELHPDKWT
VQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V L24I, Q58E L10I, K20I, E35D, L63Q, I64V, T74S  
>880904| codons 1-99
PQITLWQRPIVTIKIGGQLIEALIDTGADDTVLEDMNLPGRWKPKIIGGIGGFVKVREYD
QIQVEICGHKAIGSVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005