<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880814 880814 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 DDI+ D4T 60
3 D4T+ 3TC+ SQV 52
4 D4T+ 3TC+ NFV 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L23I, F53L, G73S L10I, K20I, N37H, R41K, L63P, A71V, V77I  
>880814| codons 1-99
PQITLWQRPIVTIKIGGQLIEAILDTGADDTVLEEMHLPGKWKPKIIGGIGGLIKVRQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, Q151M V75I, F116Y     K49R, I50V, V60I, S68G, T69I, K122E, I135T, I142M, T165I, D177E, F214L, V245M  
>880814| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRVGPENPYNTPI
FAIKRKDGIKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPMGWKGSPAIFQSSMIKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKD

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005