<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880806 880806 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 112
2 D4T+ 3TC+ SQV 60
3 D4T+ 3TC+ IDV 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L63P, A71T  
>880806| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K43N, K49R, R83K, K122E, I135V, E138A, S162N, E169K, K173E, I178L, G196E, Q207E, R211K L234P, D237H
>880806| codons 1-246
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQNSMTKILKPFREQNPDLVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYEPHPHKWT
VQPIVL

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005