<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880716 880716 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+ DDC 165
3 AZT+ DDC+ 3TC+ IDV 52
4 D4T+ NVP+ NFV 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L210W, T215Y   K103N, Y181C, G190A   K43Q, K49R, V118I, D123E, I135L, S162D, Q174N, D177E, E194Q, G196E, T200A, I202V, R211K  
>880716| codons 1-246
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEQEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKNNPEIVI
CQYMDDLYVASDLQIEQHRAKVEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I Q58E, G73S K20I, L63P, I64V, A71V, V77I, I93L  
>880716| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYD
QIPVEICGHKVISTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005