Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| 880715 | 880715 | Spain | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 108 |
| 2 | AZT+ DDC | 56 |
| 3 | D4T+ 3TC+ RTV | 86 |
| 4 | DDI+ D4T+ NVP+ NFV | 44 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, V82A, L90M | L10I, L63P, A71I, V77I, I93L |
| >880715| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD QIPIEICGHKIIGTVLIGPTPANIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Tural, C | Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. | AIDS, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |