<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880509 880509 Spain 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 DDI 30
3 AZT+ DDI 25
4 AZT+ DDC 82
5 AZT+ DDC+ SQV 39
6 DDC+ D4T+ SQV 8
7 D4T+ 3TC+ IDV 82
8 D4T+ NVP+ NFV 8
9 D4T+ IDV+ NFV 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, L19I, L63P, I64L, A71I, I72K, V77I, V82I, I93M, C95F R87S
>880509| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPLEICGHKIKGTVLIGPTPINIIGSNLMTQMGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y   K103N, Y181C   K49R, I50V, K122E, I135T, S162C, L228H, P243S  
>880509| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQSIVLPEKD

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005