<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880423 880423 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 161
2 AZT+ DDI 56
3 AZT+ DDC 76
4 AZT+ 3TC 94
5 D4T+ 3TC+ IDV 40
6 D4T+ NVP+ NFV 37
7 D4T+ NVP+ SQV+ NFV 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   Y181C   V35I, K43Q, A98S, D121Y, K122E, A158S, K166R, D177E, R211K  
>880423| codons 1-233
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTRILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M L23I L10I, E35D, N37D, R41K, F53Y, L63P, A71T, I72V, V77I, Q92R, I93L  
>880423| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEDMDLPGKWKPKIIGGIGGYVKVRQYD
QIPIEICGHKTVGTVLIGPTPFNIIGRNLMTRLGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005