<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880419 880419 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 AZT+ DDC 34
3 AZT+ DDI 4
4 DDI+ D4T+ RTV 13
5 AZT+ 3TC 13
6 D4T+ 3TC+ SQV 130
7 AZT+ 3TC+ NVP+ NFV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   K20R, E35D, M36I, N37E, I62V, L63P, A71V, V77I, I93L  
>880419| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N, Y181C   T39S, I142V, T200A, I202V, R211K, L228R  
>880419| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRAKVEELRQHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005