<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880418 880418 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+ DDC 91
3 AZT+ 3TC 59
4 AZT+ 3TC+ RTV 29
5 D4T+ 3TC+ IDV 35
6 D4T+ 3TC+ SQV+ NFV 79

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, T215Y K219Q     V60I, K122E, I135T, D177E, I178M, T200A, Q207E, R211K  
>880418| codons 1-246
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L23I, F53L L10V, I15V, K20R, M36I, N37D, R41K, I62V, L63P, I93L  
>880418| codons 1-99
PQITLWQRPVVTIKVGGQLREAILDTGADDTVLEEIDLPGKWKPKMIGGIGGLVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005