<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1556 CA4445 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 14
3 DDI 27
4 D4T 21
5 3TC+AZT 58
6 3TC+AZT+IDV 48
7 D4T+NFV 25
8 DDC+NFV+RTV+SQV 16
9 3TC+RTV+SQV 5
10 ABC+EFV+RTV+SQV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M G73S I15V, L19P, K20I, E35G, M36I, I62V, L63P, A71IT  
>CA4445| codons 1-99
PQITLWQRPLVTIKVGGQPIEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKIISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_SG, L74LV, M184V, L210W, T215Y A62V, D67E L100I, K103N   K43E, K64R, V111I, K122E, I135T, S162Y, R211RK, L228H, V245E, A272P, K277R  
>CA4446| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FVIRKKESAKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005