<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880414 880414 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 AZT+ 3TC 19
3 D4T+ 3TC+ IDV 51
4 DDI+ D4T+ RTV+ SQV 20
5 DDI+ D4T+ NVP+ NFV 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N, Y181C   K20R, V35T, T39A, K122E, I135T, G196E, Q207K, R211A, H221Y  
>880414| codons 1-246
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIEELRKHLWAWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, T12P, N37S, I62V, L63P, I66L, I72R, V77I, I93L, C95F  
>880414| codons 1-99
PQITLWQRPIVPIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYD
QVPIELCGHKARSTVLIGPTPVNVIGRNLMTQLGFTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005