<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
880307 880307 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NFV 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V     K49R, D123E, I135T, E169D, Q197E, T200I, R211K  
>880307| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGEHRIKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10V, I15V, K20T, E35D, M36V, N37S, R41K, L63P, I85V  
>880307| codons 1-99
PQITLWQRPVVTIKVGGQLTEALLDTGADNTVLEDVSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIVGRDLLTQIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005