<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1555 CA4443 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 DDI 52
3 NRTI 47
4 3TC+AZT 13
5 3TC+AZT+RTV 8
6 3TC+AZT+IDV 30
7 3TC+D4T+IDV 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I L10I, T12A, R41K, L63P, A71V, V77I, I93L  
>CA4443| codons 1-99
PQITLWQRPIVAIKIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, M184V, T215Y K219N     K20R, V60I, A98S, I135T, K166R, E169D, G196E, T200A, R211RS, V245M  
>CA4444| codons 1-257
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLSWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005