<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1554 CA4442 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 61
2 AZT 30
3 3TC+AZT+DDI 13
4 DDI+IDV+RTV 31
5 DDI+NVP+RTV 30
6 DDC+DLV+RTV+SQV 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y K219Q K103N, Y188L   V35I, R83K, K102Q, K122E, K166R, I178L, A272P, K277R, L283I, I293V, E297K  
>CA4442| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDLVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, I84V, L90M   K20KR, E35D, M36I, N37T, D60E, Q61E, L63P, I64V, A71AV  
>CA4441| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDITLPGRWKPKIIGGIGGFVKVRQYE
EIPVEICGHKVIGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009