<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
368428 368428 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 21
3 D4T+ 3TC 30
4 D4T+ 3TC+ IDV 73
5 D4T+ 3TC+ SQV 30
6 D4T+ 3TC+ RTV+ SQV 47
7 D4T+ 3TC+ IDV 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M T74P L10I, K14R, E35D, N37D, D60E, I62V, L63P, A71I, V77I, I93L  
>368428| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYE
QVPIEICGHKIIGPVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K122E, D123N, I142V, Q174K, Q197K, T200E, E203K, Q207E, R211K  
>368428| codons 1-260
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYVDDLYVGSDLEIGKHREKIKELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005