Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| 349374 | 349374 | Spain | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 30 |
| 2 | AZT+ DDC | 43 |
| 3 | AZT+ 3TC | 30 |
| 4 | AZT+ 3TC+ IDV | 13 |
| 5 | D4T+ 3TC+ IDV | 43 |
| 6 | D4T+ 3TC+ NFV | 66 |
| 7 | D4T+ 3TC+ EFV | 18 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, V82A, L90M | L10I, R41K, L63P, A71V, T74S, I93L |
| >349374| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD QIPIEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Tural, C | Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. | AIDS, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |