<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
349374 349374 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 AZT+ DDC 43
3 AZT+ 3TC 30
4 AZT+ 3TC+ IDV 13
5 D4T+ 3TC+ IDV 43
6 D4T+ 3TC+ NFV 66
7 D4T+ 3TC+ EFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, L90M   L10I, R41K, L63P, A71V, T74S, I93L  
>349374| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPIEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005